DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Opn1mw

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_446000.1 Gene:Opn1mw / 89810 RGDID:620978 Length:359 Species:Rattus norvegicus


Alignment Length:344 Identity:93/344 - (27%)
Similarity:153/344 - (44%) Gaps:43/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCM 106
            :.|.|         :..:...:.:.::|.|...||:|:......|.||.|.|.:::|||.:|...
  Rat    42 IAPRW---------VYHLTSTWMILVVIASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAE 97

  Fly   107 MASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIK 171
            ....|.:.::|..|..:|||...|.|.....||.|...:||:.:|:::|:.|:.|.........|
  Rat    98 TIIASTISVVNQIYGYFVLGHPLCVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAK 162

  Fly   172 TSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNP--RSYLITYSLFVYYTPL 234
            .:.:.|:|.|:.|..||..|:.|||.|.|.|..|:|..|..:....|  :||::...:.....||
  Rat   163 LATVGIVFSWVWAAVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPL 227

  Fly   235 FLI--CY-SYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAW 296
            .:|  || ..|..|.|||..:|               .||...| ||.::.::.:..:..:.:.|
  Rat   228 SIIVLCYLQVWLAIRAVAKQQK---------------ESESTQK-AEKEVTRMVVVMVFAYCLCW 276

  Fly   297 TPYLVICYFGLFKID----GLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFG 357
            .||   .:|..|...    ...||.....:.|||::.:||||:|...:.::|     .|.:.:||
  Rat   277 GPY---TFFACFATAHPGYAFHPLVASLPSYFAKSATIYNPIIYVFMNRQFR-----NCILQLFG 333

  Fly   358 -NTDEPKPDAPASDTETTS 375
             ..|:....:..|.||.:|
  Rat   334 KKVDDSSELSSTSKTEVSS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 53/171 (31%)
7tm_1 74..336 CDD:278431 79/270 (29%)
Opn1mwNP_446000.1 Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 12..38
7tm_1 66..317 CDD:278431 79/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.