DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and BRS3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001718.1 Gene:BRS3 / 680 HGNCID:1113 Length:399 Species:Homo sapiens


Alignment Length:372 Identity:82/372 - (22%)
Similarity:167/372 - (44%) Gaps:43/372 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLF-TLAIMI-ISCCGNGVVVYIFGGTK 86
            :..:.||:.|      ...|..||  ....|.:..:..:: |.|::| :...||.:::.:|..||
Human    20 TESSSSVVSN------DNTNKGWS--GDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTK 76

  Fly    87 SLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMI 151
            |::|..|:.:.:|||.|..::.:..||...::..|.|:.|.:.|.:.:........||::::.::
Human    77 SMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTIL 141

  Fly   152 AFDRYNVIVKGINGTPMT--IKTSIMKILFIWMMAVFWTVMPLIGWSAYV---PEGNLT--ACSI 209
            :.|||..:||.:...|..  :||.: |...:|::::.:.:...|..:.|.   |..|:|  :|:.
Human   142 SADRYKAVVKPLERQPSNAILKTCV-KAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTS 205

  Fly   210 DYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCD 274
            ..:::......:.:...|..|..||.:|.. |:.:||...        ....:|:.:...|. ..
Human   206 YPVSKKLLQEIHSLLCFLVFYIIPLSIISV-YYSLIARTL--------YKSTLNIPTEEQSH-AR 260

  Fly   275 KSAEG--KLAKVALTTISLWFMAWTP-YLVICYFGLFKIDGLTP-----LTTIWGATFAKTSAVY 331
            |..|.  ::|:..|..::|:.:.|.| :|:..|........:.|     :.||:....|.:::..
Human   261 KQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCV 325

  Fly   332 NPI-VYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTSEA 377
            ||. :|.:| ..::...|.:...|   ..:.|:|  |.:||..|:.|
Human   326 NPFALYWLS-KSFQKHFKAQLFCC---KAERPEP--PVADTSLTTLA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 41/177 (23%)
7tm_1 74..336 CDD:278431 61/277 (22%)
BRS3NP_001718.1 7tmA_BRS-3 48..341 CDD:320251 66/304 (22%)
TM helix 1 49..75 CDD:320251 6/25 (24%)
TM helix 2 82..108 CDD:320251 7/25 (28%)
TM helix 3 120..150 CDD:320251 6/29 (21%)
TM helix 4 162..182 CDD:320251 4/20 (20%)
TM helix 5 214..239 CDD:320251 6/25 (24%)
TM helix 6 264..294 CDD:320251 7/29 (24%)
TM helix 7 309..334 CDD:320251 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.