DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and OPN1SW

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001372054.1 Gene:OPN1SW / 611 HGNCID:1012 Length:345 Species:Homo sapiens


Alignment Length:348 Identity:88/348 - (25%)
Similarity:166/348 - (47%) Gaps:50/348 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCM 106
            :.|.|:.:     :.:..:|    .:.:|....|.:|:......|.||.|.|.:::|::|..|.:
Human    25 IAPVWAFY-----LQAAFMG----TVFLIGFPLNAMVLVATLRYKKLRQPLNYILVNVSFGGFLL 80

  Fly   107 -MASQSPVMI--INFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPM 168
             :.|..||.:  .|.|:   |.|...|.:....|::.|.|:.||:..:||:||.||.|.......
Human    81 CIFSVFPVFVASCNGYF---VFGRHVCALEGFLGTVAGLVTGWSLAFLAFERYIVICKPFGNFRF 142

  Fly   169 TIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFV--YY 231
            :.|.::..:|..|.:.:..::.|..|||.::|||...:|..|:.|.....||...|:.||:  :.
Human   143 SSKHALTVVLATWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSESYTWFLFIFCFI 207

  Fly   232 TPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAW 296
            .||.|||:||..::.|:.|.....:|.|             ..:.||.:::::.:..:..:.:.:
Human   208 VPLSLICFSYTQLLRALKAVAAQQQESA-------------TTQKAEREVSRMVVVMVGSFCVCY 259

  Fly   297 TPYLVICYFGLFKID----GL-TPLTTIWGATFAKTSAVYNPIVYGISHPKYR-IVLKEKCPMCV 355
            .||..   |.::.::    || ..|.|| .:.|:|::.:||||:|...:.::: .::|..|...:
Human   260 VPYAA---FAMYMVNNRNHGLDLRLVTI-PSFFSKSACIYNPIIYCFMNKQFQACIMKMVCGKAM 320

  Fly   356 FGNTDEPKPDAPASDTETTSEAD 378
               |||       |||.::.:.:
Human   321 ---TDE-------SDTCSSQKTE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 51/174 (29%)
7tm_1 74..336 CDD:278431 75/271 (28%)
OPN1SWNP_001372054.1 7tmA_SWS1_opsin 32..311 CDD:320204 78/307 (25%)
TM helix 1 34..58 CDD:320204 4/27 (15%)
TM helix 2 67..89 CDD:320204 6/21 (29%)
TM helix 3 105..127 CDD:320204 5/21 (24%)
TM helix 4 149..165 CDD:320204 2/15 (13%)
TM helix 5 195..218 CDD:320204 9/22 (41%)
TM helix 6 245..267 CDD:320204 3/24 (13%)
TM helix 7 279..304 CDD:320204 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.