DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and grpr

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_695673.2 Gene:grpr / 567289 ZFINID:ZDB-GENE-081015-4 Length:376 Species:Danio rerio


Alignment Length:326 Identity:74/326 - (22%)
Similarity:144/326 - (44%) Gaps:38/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PMDPMMSKILGLFTLAIMIISC--CGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPV 113
            |..|.:...:.:.|:..::|:.  .||..::..|...||:|...||.:.:||..|..::.:.:||
Zfish    26 PEHPHLHSGIIIATVYALLITAGLIGNVTLIRTFCIVKSMRNVPNLFMSSLALGDVLLLVTCAPV 90

  Fly   114 MIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTS----- 173
            ....|..:.|:.|.:.|.:..........||::::..:|.|||..|||     ||.|::|     
Zfish    91 DASKFLADEWLFGRMGCKLIPFIQLTSVGVSVFTLTALAADRYKAIVK-----PMDIQSSKASLK 150

  Fly   174 -IMKILFIWMMAVFWTVMPLIG---WSAYVPEGNLT--ACSIDYMTRMWNPRSYLITYSLFVYYT 232
             .::...|||:::...:...:.   .:.::|:.|.|  .|:........:|:.:.:...|.:|..
Zfish   151 VCLRAASIWMLSMVLAIPEAVFSDLHTFHIPQTNETFKTCAPYPHAGDLHPKIHSMASFLILYII 215

  Fly   233 PLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKS---LRSSEDCDKSAEGKLAKVALTTISLWFM 294
            |||:|...|.||       .:::.:.|..|.|:.   :|...:    :..:|||..|..:.|:.:
Zfish   216 PLFIISVYYIFI-------ARSLIQSANNMPVEGNTHIRRQVE----SRMRLAKTVLVFVGLFAI 269

  Fly   295 AWTPYLVICYFGLF---KIDGLTP--LTTIWGATFAKTSAVYNPI-VYGISHPKYRIVLKEKCPM 353
            .|.|..||..:..:   ::|....  :.::.....|.|::..||. :|.:|....:...|:.|..
Zfish   270 CWLPNHVIYLYRSYHYTEVDTSMAHFIASVCARILAFTNSCVNPFALYLLSKSFRKQFNKQLCCC 334

  Fly   354 C 354
            |
Zfish   335 C 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 44/182 (24%)
7tm_1 74..336 CDD:278431 65/281 (23%)
grprXP_695673.2 7tm_1 51..314 CDD:278431 64/278 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.