DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and nmbr

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_690325.2 Gene:nmbr / 561834 ZFINID:ZDB-GENE-041014-369 Length:372 Species:Danio rerio


Alignment Length:294 Identity:66/294 - (22%)
Similarity:133/294 - (45%) Gaps:27/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLW 129
            :.|:.:...||..:|.||..|.::|:..|:.:.:||..|..::.:..||....::||.|:.|.:.
Zfish    40 ILIITVGLLGNITLVKIFITTSAMRSVPNIFISSLAVGDLLLLVTCVPVDAFRYFYEEWIFGTVA 104

  Fly   130 CDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTS------IMKILFIWMMAVFWT 188
            |.:..........||::::..::.||:..||     .||.|::|      .:|.:.||:::|...
Zfish   105 CKMIPVIQLTSVGVSVFTLTALSADRHKAIV-----NPMDIQSSSAVFWTCLKAITIWVVSVLLA 164

  Fly   189 VMPLI-GWSAYVPEGN--LTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAA 250
            :...: ....::|:.|  .|||....::...:|:.:.|...|..:..||.:|...|:.|...:. 
Zfish   165 IPEAVFSQVVHMPDKNTTFTACVPYPLSNEMHPKIHSIMIFLVYFLIPLSIISVYYYHIARTLI- 228

  Fly   251 HEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLF---KIDG 312
              |:..:...:::..|.|.:|     ...:|||:.|..:.|:.:.|.|..|:..:..|   :||.
Zfish   229 --KSAHDMPGEISEHSKRQTE-----TRKRLAKIVLVFVGLFALCWFPNHVLYMYRSFNYRQIDS 286

  Fly   313 LTP--LTTIWGATFAKTSAVYNPIVYGISHPKYR 344
            ...  :.|:.....:.:|:..||....:....:|
Zfish   287 SLSHLIITLVARVLSFSSSCVNPFALYLLSESFR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 43/178 (24%)
7tm_1 74..336 CDD:278431 64/275 (23%)
nmbrXP_690325.2 7tm_1 49..310 CDD:278431 63/273 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.