DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001104634.1 Gene:opn3 / 561815 ZFINID:ZDB-GENE-080227-16 Length:387 Species:Danio rerio


Alignment Length:322 Identity:94/322 - (29%)
Similarity:157/322 - (48%) Gaps:35/322 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTL-AIMIISCCGNGVVVYIFGGTKSLRTPANLLV 96
            |..|..|||.| |...||   ....|:| .||: :|.::..|.|.:|:.::...|.||||.|||:
Zfish     5 NETPTEAHLEN-YNYIFA---DETYKLL-TFTIGSIGVLGFCNNIIVIILYSRYKRLRTPTNLLI 64

  Fly    97 LNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAG-CGSLFGCVSIWSMCMIAFDRYNVIV 160
            :|::.||..:..:......::.....||.....| ::.| ..||||.|||.::..:|::||   :
Zfish    65 VNISVSDLLVSLTGVNFTFVSCVKRRWVFNSATC-VWDGFSNSLFGIVSIMTLSGLAYERY---I 125

  Fly   161 KGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITY 225
            :.::...:....:...|..||:.::.||..||:||:.|..|.:...||:|:.::..|..|:::.:
Zfish   126 RVVHAKVVDFPWAWRAITHIWLYSLAWTGAPLLGWNRYTLEVHQLGCSLDWASKDPNDASFILFF 190

  Fly   226 SLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDK-------SAEGKLAK 283
            .|..::.|:.::.|.|..|:                ..||.|||.:|...       ..|.|:|.
Zfish   191 LLGCFFVPVGVMVYCYGNIL----------------YTVKMLRSIQDLQTVQTIKILRYEKKVAV 239

  Fly   284 VALTTISLWFMAWTPYLVICYFGLF-KIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYR 344
            :.|..||.:.:.||||.|:.....| |...::|...|..:.|||:|..|||::|.....|:|
Zfish   240 MFLMMISCFLVCWTPYAVVSMLEAFGKKSVVSPTVAIIPSLFAKSSTAYNPVIYAFMSRKFR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 47/170 (28%)
7tm_1 74..336 CDD:278431 76/270 (28%)
opn3NP_001104634.1 7tm_1 43..293 CDD:278431 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.