DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn6b

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001303879.1 Gene:opn6b / 557053 ZFINID:ZDB-GENE-030616-402 Length:391 Species:Danio rerio


Alignment Length:335 Identity:91/335 - (27%)
Similarity:152/335 - (45%) Gaps:59/335 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMA---SQSPVMIIN-FYY 120
            :|::.:.:..:|..|||.|:.:....:....|.:.|.||||.||..:..   |:..:.:.: |..
Zfish    24 IGVYLVILGWLSWIGNGTVILLLTKQRKALEPQDFLTLNLAISDASISIFGYSRGILEVFDVFRD 88

  Fly   121 ETWVLGPLW-CDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKG--------INGTPMTIKTSI-M 175
            |.:::...| |.:......|||.:||.::..|:..||   :||        ||      |.:| :
Zfish    89 EGYLIKTFWTCKVDGFLILLFGLISINTLTAISVIRY---IKGCHPHHAHHIN------KRNICL 144

  Fly   176 KILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFV-------YYTP 233
            .|..:|:..:||...||:||.:|...|..| |.||     |....|.|.:.|:|       ::.|
Zfish   145 VITAVWLFCLFWAGAPLLGWGSYRARGYGT-CEID-----WTRALYSIPFKLYVIGIFFFNFFVP 203

  Fly   234 LFLICYSYWFIIAAVAAHEKA-----MREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWF 293
            ||:|.::|..||..|.:..|:     :.|:.||:               |..:.:|:|...:.:.
Zfish   204 LFIIVFAYVSIIRTVNSSHKSSQGGDVSERQKKI---------------ERSITRVSLILCAAFL 253

  Fly   294 MAWTPYLVICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVY-GISHPKYRIVLKEKCPMCVFG 357
            :||:||.||..:...... :..|..|..:.|||:::.|||.:| |:| .|:|..|:.........
Zfish   254 LAWSPYAVISMWSALGYQ-IPTLNGILASLFAKSASFYNPFIYIGMS-SKFRKDLQALFYCLRPT 316

  Fly   358 NTDEPKPDAP 367
            :...|.|.||
Zfish   317 SAHRPTPPAP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 54/190 (28%)
7tm_1 74..336 CDD:278431 79/287 (28%)
opn6bNP_001303879.1 7tm_1 38..295 CDD:278431 79/287 (28%)
7tm_4 <204..306 CDD:304433 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.