DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Opn3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001178862.1 Gene:Opn3 / 498289 RGDID:1594385 Length:400 Species:Rattus norvegicus


Alignment Length:342 Identity:82/342 - (23%)
Similarity:153/342 - (44%) Gaps:49/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 APM-DPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPV 113
            ||: .|...:.|.|....:.::...||.:|:.::.....||||.:|.::||:..|..:.......
  Rat    31 APLFSPTAYERLALLLGCLALLGVGGNLLVLLLYSKFPRLRTPTHLFLVNLSLGDLLVSLFGVTF 95

  Fly   114 MIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKIL 178
            ...:.....||...:.|......|||||.|||.::.::|::||   ::.::...:....:...|.
  Rat    96 TFASCLRNGWVWDAVGCAWDGFSGSLFGFVSITTLTVLAYERY---IRVVHARVINFSWAWRAIT 157

  Fly   179 FIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWF 243
            :||:.::.|...||:||:.|:.:.:...|::|:.::..|..|:::...|.....|:.:|.:.|..
  Rat   158 YIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPMGIIAHCYGH 222

  Fly   244 IIAAVAAHEKAMREQAKKMNVKSLRSSEDCDK-------SAEGKLAKVALTTISLWFMAWTPYLV 301
            |:                .:|:.||..||...       ..|.|:||:......::...|.||:|
  Rat   223 IL----------------YSVRMLRCVEDLQTIQVIKMLRYEKKVAKMCFLMAFVFLTCWMPYVV 271

  Fly   302 ICYFGLFKIDG----LTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKE-------KCPMCV 355
            ..:   ..::|    :||..:|....|||:|.||||::|.....|:|..|.:       :|    
  Rat   272 TRF---LVVNGYGHLVTPTVSIVSYLFAKSSTVYNPVIYIFMIRKFRRSLLQLLCFRLLRC---- 329

  Fly   356 FGNTDEPKPDAPASDTE 372
                ..|..:.||:::|
  Rat   330 ----QRPAKNLPAAESE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 40/169 (24%)
7tm_1 74..336 CDD:278431 68/272 (25%)
Opn3NP_001178862.1 7tm_GPCRs 64..317 CDD:421689 68/274 (25%)
TM helix 2 74..101 CDD:410628 4/26 (15%)
TM helix 3 112..142 CDD:410628 12/32 (38%)
TM helix 4 150..172 CDD:410628 5/21 (24%)
TM helix 5 197..227 CDD:410628 6/45 (13%)
TM helix 6 246..276 CDD:410628 8/32 (25%)
TM helix 7 286..311 CDD:410628 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.