DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and gpr151

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_009289581.1 Gene:gpr151 / 497134 ZFINID:ZDB-GENE-050128-2 Length:418 Species:Danio rerio


Alignment Length:402 Identity:81/402 - (20%)
Similarity:147/402 - (36%) Gaps:103/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SSGNGSVLDNVLPDMAHLVNPYWSRFAPMDP-----MMSKILGLFTLAIMIISCCGN--GVVVYI 81
            ||||.||      |....:..  |.:..::|     ::..:||:    |.::...||  .:.|.|
Zfish    10 SSGNSSV------DRRSFLES--SGYQHLEPGELRVLIPVLLGV----ICVLGFSGNVTAMGVLI 62

  Fly    82 FGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPL---WCDIYAGCGSLFGCV 143
            ....||..:..|.|:|||..:|..::|...|.....:...:|.||..   .||.:     |..|:
Zfish    63 TNARKSKLSLINGLILNLMMADGLVLAFTVPFRAAAYSRASWTLGLFICKTCDWF-----LHSCM 122

  Fly   144 SI--WSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGW--SAYVPEGNL 204
            :.  :::.::|...|..:........:.:||.::.::..|::|   .|:||..|  |....|.|.
Zfish   123 AAKSFTVAIMAKACYRYVSNPTKQVSIRMKTILVVLMLAWLLA---CVLPLPQWLFSKLQKEPNG 184

  Fly   205 TAC-------SIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKM 262
            ..|       :.::|:      .|:..|.|..|..||.:....:|      .|:.:..|..:|..
Zfish   185 MVCVQMVPLHAHNFMS------IYVKAYPLLAYCMPLSVALLYFW------KAYGRCQRRSSKTQ 237

  Fly   263 NVKS-LRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDGLTPLTTIWGATFAK 326
            |::: :||     :.....|..:.:...|:|...|..:                   :|.....:
Zfish   238 NLRTQIRS-----RKLTLMLFSLTVAMASMWLPQWVSW-------------------VWMRHAVE 278

  Fly   327 TSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDE------------------PK-------PDA 366
            |...:.|:::.:|.......:....|:.|...::|                  ||       |.|
Zfish   279 TGGGFPPVLFSLSAQILMFSISLINPLIVLSLSEEFREGYIDLWRRLTLRKQPPKNKPGPHTPTA 343

  Fly   367 PASDTETTSEAD 378
            |.|.|.....||
Zfish   344 PKSPTPRQETAD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 43/185 (23%)
7tm_1 74..336 CDD:278431 56/278 (20%)
gpr151XP_009289581.1 7tm_1 53..306 CDD:278431 58/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.