DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and NMBR

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_002502.2 Gene:NMBR / 4829 HGNCID:7843 Length:390 Species:Homo sapiens


Alignment Length:327 Identity:70/327 - (21%)
Similarity:136/327 - (41%) Gaps:47/327 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WSR-FAP------MDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSD 103
            |.| |.|      .:.::..::....|.|:.:...||.::|.||....::|:..|:.:.|||..|
Human    25 WERDFLPASDGTTTELVIRCVIPSLYLLIITVGLLGNIMLVKIFITNSAMRSVPNIFISNLAAGD 89

  Fly   104 FCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPM 168
            ..::.:..||....::::.|:.|.:.|.:..........||::::..::.|||..||     .||
Human    90 LLLLLTCVPVDASRYFFDEWMFGKVGCKLIPVIQLTSVGVSVFTLTALSADRYRAIV-----NPM 149

  Fly   169 TIKTS------IMKILFIWMMAVFWTVMPLIGWS-----AYVPEGNLTACSIDY-MTRMWNPRSY 221
            .::||      .:|.:.||:::|...| |...:|     :.:...:.||| |.| .|...:|:.:
Human   150 DMQTSGALLRTCVKAMGIWVVSVLLAV-PEAVFSEVARISSLDNSSFTAC-IPYPQTDELHPKIH 212

  Fly   222 LITYSLFVYYTPLFLICYSYWFIIAAV--AAHE--KAMREQAKKMNVKSLRSSEDCDKSAEGKLA 282
            .:...|..:..||.:|...|:.|...:  :||.  ....|..||            ......:||
Human   213 SVLIFLVYFLIPLAIISIYYYHIAKTLIKSAHNLPGEYNEHTKK------------QMETRKRLA 265

  Fly   283 KVALTTISLWFMAWTPYLVICYFGLFKIDGLTP-----LTTIWGATFAKTSAVYNPIVYGISHPK 342
            |:.|..:..:...|.|..::..:..|..:.:.|     :.|:.....:..::..||....:....
Human   266 KIVLVFVGCFIFCWFPNHILYMYRSFNYNEIDPSLGHMIVTLVARVLSFGNSCVNPFALYLLSES 330

  Fly   343 YR 344
            :|
Human   331 FR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 45/181 (25%)
7tm_1 74..336 CDD:278431 63/282 (22%)
NMBRNP_002502.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
7tm_1 60..322 CDD:278431 62/280 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.