DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and rrh

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001004654.1 Gene:rrh / 447916 ZFINID:ZDB-GENE-040912-94 Length:334 Species:Danio rerio


Alignment Length:313 Identity:85/313 - (27%)
Similarity:150/313 - (47%) Gaps:32/313 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETW 123
            |:..:.:...:||...|.||:.:|...:.|||..|.:::||||:|..:.....|:...:..:.:|
Zfish    27 IVAAYLITAGVISLSSNIVVLLMFVKFRELRTATNAIIINLAFTDIGVAGIGYPMSAASDLHGSW 91

  Fly   124 VLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWT 188
            ..|.:.|.|||.....||..||..:.::|.|||..|.:...|..:|.::..:.|:..|:.||||:
Zfish    92 KFGYMGCQIYAALNIFFGMASIGLLTVVAIDRYLTICRPDIGQKLTTRSYTLLIVAAWLNAVFWS 156

  Fly   189 VMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEK 253
            .||::||:.|.|:.....|:|::.....:..||.:|.....:..||.::.|.|:.:.|.|     
Zfish   157 SMPIVGWAGYAPDPTGATCTINWRNNDTSFVSYTMTVITVNFIIPLSVMFYCYYNVSATV----- 216

  Fly   254 AMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLF----KIDGLT 314
                  |:....:...|.:.|.|.:..:.|:::..|.::..||:||.::|.:..|    ||.  .
Zfish   217 ------KRFKASNCLDSINMDWSDQMDVTKMSVIMIVMFLAAWSPYSIVCLWASFGDPQKIP--A 273

  Fly   315 PLTTIWGATFAKTSAVYNPIVYGISHPKY--------------RIVLKEKCPM 353
            |:..| ....||:|..|||.:|.|::.|:              |:.:..:.||
Zfish   274 PMAII-APLLAKSSTFYNPCIYVIANKKFRRAIIGMIRCQTRQRVTINNQLPM 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 52/169 (31%)
7tm_1 74..336 CDD:278431 76/265 (29%)
rrhNP_001004654.1 7tm_1 43..294 CDD:278431 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.