DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn1lw2

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001002443.1 Gene:opn1lw2 / 436716 ZFINID:ZDB-GENE-040718-141 Length:356 Species:Danio rerio


Alignment Length:378 Identity:94/378 - (24%)
Similarity:163/378 - (43%) Gaps:52/378 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 FQAQSSGNGSVLDNVL--------------PDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMII 70
            |.|:..|:.:..||..              |:  :.:.|.|         :..:..::...:::.
Zfish     9 FAARRRGDETTRDNAFSYTNSNNTRDPFEGPN--YHIAPRW---------VYNVATVWMFFVVVA 62

  Fly    71 SCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAG 135
            |...||:|:......|.||.|.|.:::|||.:|.......|.:.:||..:..::||...|.....
Zfish    63 STFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETLFSSTISVINQVFGYFILGHPMCIFEGY 127

  Fly   136 CGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVP 200
            ..|:.|...:||:.:|:::|:.|:.|.........|.:...|:|.|:.|..|...|:.|||.|.|
Zfish   128 TVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDGKWASAGIIFSWVWAAVWCAPPIFGWSRYWP 192

  Fly   201 EGNLTACSIDYMTRMWNP--RSYLITYSLFVYYTPL--FLICYSYWFI-IAAVAAHEKAMREQAK 260
            .|..|:|..|......:|  :||::...:.....||  .::||...|: |.|||..:|       
Zfish   193 HGLKTSCGPDVFGGNEDPGVQSYMLVLMITCCILPLAIIILCYIAVFLAIHAVAQQQK------- 250

  Fly   261 KMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVI-CYFGLFKIDGLTPLTTIWGATF 324
                    .||...| ||.:::::.:..:..:.:.|.||... |:..........||.....|.|
Zfish   251 --------DSESTQK-AEKEVSRMVVVMVLAFCLCWGPYTAFACFAAANPGYAFHPLAAAMPAYF 306

  Fly   325 AKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTSEA 377
            ||::.:||||:|...:.::|:     |.|.:||...:...:...|.||.:|.|
Zfish   307 AKSATIYNPIIYVFMNRQFRV-----CIMQLFGKKVDDGSEVSTSKTEVSSVA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 48/173 (28%)
7tm_1 74..336 CDD:278431 74/267 (28%)
opn1lw2NP_001002443.1 7tm_4 57..>185 CDD:304433 34/127 (27%)
7tm_1 67..318 CDD:278431 74/266 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.