DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Rh3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_524411.1 Gene:Rh3 / 42398 FlyBaseID:FBgn0003249 Length:383 Species:Drosophila melanogaster


Alignment Length:383 Identity:147/383 - (38%)
Similarity:219/383 - (57%) Gaps:14/383 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERSHLPETPFDLAHSGPRFQAQSSGNGSVLD-NVLPDMAHLVNPYWSRFAPMDPMMSKILGLFT 64
            ||..::..:.|....:..|.:|:.|....:|. ||.|:....:..:|..:......|:.:||...
  Fly     1 MESGNVSSSLFGNVSTALRPEARLSAETRLLGWNVPPEELRHIPEHWLTYPEPPESMNYLLGTLY 65

  Fly    65 LAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLW 129
            :...::|..|||:|:::|...||||||:|:||:||||.||.||. ::|:.|.|.:::.:.||.|.
  Fly    66 IFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCDFMMMV-KTPIFIYNSFHQGYALGHLG 129

  Fly   130 CDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLI- 193
            |.|:...||..|..:..:...||:||:|||.:.:.| .||...:|..|:||:|.|..|.|.... 
  Fly   130 CQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPMEG-KMTHGKAIAMIIFIYMYATPWVVACYTE 193

  Fly   194 GWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQ 258
            .|..:||||.||:|:.||:|..::.|.::.....|.:..|..:|.|.|..|:..|.:||||:|:|
  Fly   194 TWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQ 258

  Fly   259 AKKMNVKSLRSSEDCDK-SAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDG----LTPLTT 318
            ||||||:||||:.|.:| :||.::||.|:|...|:|.:||||.|:...|.|   |    |||..|
  Fly   259 AKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPYGVMSLIGAF---GDKTLLTPGAT 320

  Fly   319 IWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTSE 376
            :..|...|..|..:|.||.||||:||:.|:::||.... |...|:..|.|| |.||.|
  Fly   321 MIPACACKMVACIDPFVYAISHPRYRMELQKRCPWLAL-NEKAPESSAVAS-TSTTQE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 66/170 (39%)
7tm_1 74..336 CDD:278431 112/267 (42%)
Rh3NP_524411.1 7tm_4 66..>191 CDD:304433 52/126 (41%)
7tm_1 75..338 CDD:278431 112/267 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BCHK
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3575
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6356
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
65.790

Return to query results.
Submit another query.