DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Lkr

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_647968.3 Gene:Lkr / 38622 FlyBaseID:FBgn0035610 Length:542 Species:Drosophila melanogaster


Alignment Length:329 Identity:72/329 - (21%)
Similarity:140/329 - (42%) Gaps:62/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSD-----FCMMASQSPVMIINF 118
            :|.:|...|.|::..||.:|:::...|:.:||..|:.:.||||:|     ||:     |......
  Fly    37 LLSIFYGGISIVAVIGNTLVIWVVATTRQMRTVTNMYIANLAFADVIIGLFCI-----PFQFQAA 96

  Fly   119 YYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILF--IW 181
            ..::|.|....|.......:|...||::::..||.||:..|:..:...|...   :.|.:.  ||
  Fly    97 LLQSWNLPWFMCSFCPFVQALSVNVSVFTLTAIAIDRHRAIINPLRARPTKF---VSKFIIGGIW 158

  Fly   182 MMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMW--NPRSYLIT------------------YS 226
            |:|:.:.|...|            |..::.:|..:  |..:|.:|                  |:
  Fly   159 MLALLFAVPFAI------------AFRVEELTERFRENNETYNVTRPFCMNKNLSDDQLQSFRYT 211

  Fly   227 L-FVYYTPLFLICYSYWFIIAAVAA-HEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTI 289
            | ||.|...|.: .|:.:|..||.. ..:|........::..|::.:        |:.|:.:..:
  Fly   212 LVFVQYLVPFCV-ISFVYIQMAVRLWGTRAPGNAQDSRDITLLKNKK--------KVIKMLIIVV 267

  Fly   290 SLWFMAWTPYLV--ICYFGLFKIDGLTPLTTIWGAT--FAKTSAVYNPIVYGISHPKYRIVLKEK 350
            .::.:.|.|..:  |.|..:.:|:....::.:|...  .|.:::.|||.:|||.:.|::....::
  Fly   268 IIFGLCWLPLQLYNILYVTIPEINDYHFISIVWFCCDWLAMSNSCYNPFIYGIYNEKFKREFNKR 332

  Fly   351 CPMC 354
            ...|
  Fly   333 FAAC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 47/197 (24%)
7tm_1 74..336 CDD:278431 63/294 (21%)
LkrNP_647968.3 7tm_4 46..329 CDD:304433 68/311 (22%)
7tm_1 52..318 CDD:278431 63/294 (21%)
PHA03216 467..>519 CDD:177558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.