DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and parapinopsinb

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001005312.1 Gene:parapinopsinb / 368725 ZFINID:ZDB-GENE-030616-134 Length:322 Species:Danio rerio


Alignment Length:291 Identity:70/291 - (24%)
Similarity:133/291 - (45%) Gaps:21/291 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDF-CMMASQSPVMIINF- 118
            :|.::.:|::..:::    |..|:.:....|.||.|.|..::|||.:|. ..:....|.::.|. 
Zfish    32 LSLLMAVFSITSVVL----NATVIVVTLRHKQLRQPLNFALVNLAVADLGTTLTGSVPSVVTNAV 92

  Fly   119 -YYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWM 182
             ||   ::|.:.|.:...|.:.||..::.::.:||.:|..|:.:.:.......:.:...:|..|:
Zfish    93 GYY---IMGRIGCVLEGFCVAFFGISALCTVALIAVERLFVVCRPLGSITFQCRHAAGGLLSCWL 154

  Fly   183 MAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAA 247
            .::.|...||:||.:|..||..|:|...:.:|.....||:|.|....:..|..:|..||.:::..
Zfish   155 WSLIWNTPPLLGWGSYQLEGAGTSCGPHWQSRELRDVSYIICYFSVCFAVPFAIILVSYSWLLYT 219

  Fly   248 VAAHEKAMREQAKKMNVKSLRSSEDCDKS---AEGKLAKVALTTISLWFMA---WTPYLVICYFG 306
            :   .:.:.|....:....:..|...|..   ...|....|||.: |:|:.   |.||..:....
Zfish   220 L---RQVLLEMVNNLGTFGMLFSAYYDLGHIFKHYKHCNAALTLV-LFFVVEYHWLPYAALALTV 280

  Fly   307 LFKID-GLTPLTTIWGATFAKTSAVYNPIVY 336
            :.|.: .|..|..:.....||:|.||||::|
Zfish   281 VSKPEVQLAVLVKVLPIYMAKSSTVYNPLIY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 42/172 (24%)
7tm_1 74..336 CDD:278431 67/271 (25%)
parapinopsinbNP_001005312.1 7tm_1 47..311 CDD:278431 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.