DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Rh5

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster


Alignment Length:344 Identity:131/344 - (38%)
Similarity:190/344 - (55%) Gaps:9/344 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SGPR-FQAQSSGNGSV--LDNVLP-DMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNG 76
            |||: :...|.|:|||  :.:..| :..|:|:.:|..|............:..:.:|:.|..|||
  Fly     7 SGPQAYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPIYYHAGFYIAFIVLMLSSIFGNG 71

  Fly    77 VVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFG 141
            :|::||..:||||||:|||:||||..|. .|.:..|..:||......|.|.|.|||||..|.:.|
  Fly    72 LVIWIFSTSKSLRTPSNLLILNLAIFDL-FMCTNMPHYLINATVGYIVGGDLGCDIYALNGGISG 135

  Fly   142 CVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIG-WSAYVPEGNLT 205
            ..:..:...||||||..|...|:|. ::....::.|||.|:.|..::|:||.. |..|.|||.||
  Fly   136 MGASITNAFIAFDRYKTISNPIDGR-LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLT 199

  Fly   206 ACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSS 270
            .||.||:|.....|.::.|..::.|..|:.:|..||:.:...|..|||.:.|||||||||||.::
  Fly   200 TCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSAN 264

  Fly   271 EDCDK-SAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDGL-TPLTTIWGATFAKTSAVYNP 333
            .:.|. |.|.::||.||....|:.:|||||.|:...|.|....| ||..::......|:.:..:|
  Fly   265 ANADNMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLDP 329

  Fly   334 IVYGISHPKYRIVLKEKCP 352
            .||..||||||:.|:.:.|
  Fly   330 WVYATSHPKYRLELERRLP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 69/170 (41%)
7tm_1 74..336 CDD:278431 106/264 (40%)
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 71/177 (40%)
7tm_1 69..332 CDD:278431 106/264 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42416
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.