DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn1sw1

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_571394.1 Gene:opn1sw1 / 30582 ZFINID:ZDB-GENE-991109-25 Length:336 Species:Danio rerio


Alignment Length:365 Identity:93/365 - (25%)
Similarity:170/365 - (46%) Gaps:55/365 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRT 90
            ||.|.:.....:..|:. |.|:.:     :.:..:|.    :.|:....||:|:::....|.||.
Zfish     9 GNASKVSPFEGEQYHIA-PKWAFY-----LQAAFMGF----VFIVGTPMNGIVLFVTMKYKKLRQ 63

  Fly    91 PANLLVLNLAFSDF---CMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIA 152
            |.|.:::|::.:.|   ....||..|.....||.   ||...|.:.|..||:.|.|:.||:.::|
Zfish    64 PLNYILVNISLAGFIFDTFSVSQVSVCAARGYYS---LGYTLCSMEAAMGSIAGLVTGWSLAVLA 125

  Fly   153 FDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRM-- 215
            |:||.||.|...........::..::|.|::.......|..|||.|:|||..|||..|:.|:.  
Zfish   126 FERYVVICKPFGSFKFGQGQAVGAVVFTWIIGTACATPPFFGWSRYIPEGLGTACGPDWYTKSEE 190

  Fly   216 WNPRSYLITYSLFV--YYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAE 278
            :|..||  ||.|.:  :..|:.:|.:||..::.|:.|             |.:.::..:..:.||
Zfish   191 YNSESY--TYFLLITCFMMPMTIIIFSYSQLLGALRA-------------VAAQQAESESTQKAE 240

  Fly   279 GKLAKVALTTISLWFMAWTPYLVIC-YFGL-------FKIDGLTPLTTIWGATFAKTSAVYNPIV 335
            .:::::.:..:..:.:.:.||.|.. ||..       :::..:.       |.|:|:|:||||::
Zfish   241 REVSRMVVVMVGSFVLCYAPYAVTAMYFANSDEPNKDYRLVAIP-------AFFSKSSSVYNPLI 298

  Fly   336 YGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTS 375
            |...:.::...:.|    .|||...:...:. :|.|||:|
Zfish   299 YAFMNKQFNACIME----TVFGKKIDESSEV-SSKTETSS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 55/176 (31%)
7tm_1 74..336 CDD:278431 75/276 (27%)
opn1sw1NP_571394.1 7tm_4 39..310 CDD:304433 77/299 (26%)
7tm_1 48..299 CDD:278431 75/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.