DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and exorh

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_571287.1 Gene:exorh / 30459 ZFINID:ZDB-GENE-991229-12 Length:354 Species:Danio rerio


Alignment Length:377 Identity:97/377 - (25%)
Similarity:173/377 - (45%) Gaps:55/377 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYI 81
            ||.|....|....::.:...:..:.:...|........|:..|||.|.:         |.:.:|:
Zfish     6 GPNFYVPMSNRTGLVRSPFEEPQYYLAEPWQFSLLAAYMLFLILGSFPI---------NALTLYV 61

  Fly    82 FGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIW 146
            ....|.||||.|.::||||.:|..|:.....|.:....:..::||...|:|.....:|.|.:::|
Zfish    62 TVQHKKLRTPLNYILLNLAVADLFMVLGGFTVTLYTALHGYFLLGVTGCNIEGFFATLGGEIALW 126

  Fly   147 SMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDY 211
            |:.::|.:||.|:.|.::......|.:|:.:.|.|:||:...|.||:|||.|:|||...:|.|||
Zfish   127 SLVVLAIERYIVVCKPMSTFRFGEKHAIIGVGFTWVMALTCAVPPLLGWSRYIPEGMQCSCGIDY 191

  Fly   212 MTRMWNPR------SYLITYSLFVYYTPLFLI--CYSYWFIIAAVAAHEKAMREQAKKMNVKSLR 268
            .|    |:      |::|...:..:..||.:|  |||........||.::...|..::       
Zfish   192 YT----PKPEVHNTSFVIYMFILHFSIPLLIIFFCYSRLLCTVRAAAAQQQESETTQR------- 245

  Fly   269 SSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDG--LTPLTTIWGATFAKTSAVY 331
                    ||.::.::.:..:..:.:.|.||..:.:: :|...|  ..|:.....|.|||::|:|
Zfish   246 --------AEREVTRMVVVMVIAFLVCWVPYASVAWY-IFANQGAEFGPVFMTVPAFFAKSAALY 301

  Fly   332 NPIVYGISHPKYRIVLKEKC---PMCVFGNTDEPKPDAPASDTETTSEADSK 380
            ||::|.:.:.::|     .|   .:|...|        |.::.|::|...||
Zfish   302 NPVIYIMLNRQFR-----NCMLSTVCCGKN--------PLAEDESSSAVSSK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 54/175 (31%)
7tm_1 74..336 CDD:278431 77/271 (28%)
exorhNP_571287.1 Rhodopsin_N 2..37 CDD:287397 5/30 (17%)
7tm_4 48..>248 CDD:304433 66/227 (29%)
7tm_1 55..306 CDD:278431 77/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.