DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Brs3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_690058.1 Gene:Brs3 / 260319 RGDID:628645 Length:399 Species:Rattus norvegicus


Alignment Length:326 Identity:79/326 - (24%)
Similarity:149/326 - (45%) Gaps:36/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TLAIMI-ISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGP 127
            |.|::| :...||.:::.:|..|||::|..|:.:.:|||.|..::.:..||...::..|.|:.|.
  Rat    53 TYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGK 117

  Fly   128 LWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPM-TIKTSIMKILFIWMMAVFWTVMP 191
            :.|.:.:........||::::.:::.|||..:||.:...|. .|..:..|...||:||:.:.:..
  Rat   118 VGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCAKAGGIWIMAMIFALPE 182

  Fly   192 LIGWSAYV---PEGNLT--AC-SIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAA 250
            .|..:.|.   |..|:|  :| |.....|:......|:.:.:| |..||.:|.. |:.:||... 
  Rat   183 AIFSNVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVF-YIIPLSIISV-YYSLIARTL- 244

  Fly   251 HEKAMREQAKKMNVKSLRSSEDCDKSAEG--KLAKVALTTISLWFMAWTPYLVICYFGLFKIDGL 313
                   ....:|:.:...|. ..|..|.  ::||..|..::|:.:.|.|..::..:..|..:..
  Rat   245 -------YKSTLNIPTEEQSH-ARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYHSFTYESY 301

  Fly   314 TP------LTTIWGATFAKTSAVYNPI-VYGISHPKYRIVLKE-KCPMCVFGNTDEPKPDAPASD 370
            ..      :.||:....|.:::..||. :|.:|    :...|. |..:|.| ..::|:|  |..|
  Rat   302 AEPSDVPFVVTIFSRVLAFSNSCVNPFALYWLS----KTFQKHFKAQLCCF-KAEQPEP--PLGD 359

  Fly   371 T 371
            |
  Rat   360 T 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 46/177 (26%)
7tm_1 74..336 CDD:278431 65/277 (23%)
Brs3NP_690058.1 7tm_1 64..328 CDD:278431 64/274 (23%)
7tm_4 <137..347 CDD:304433 49/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.