DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Grpr

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_036838.1 Gene:Grpr / 24938 RGDID:2750 Length:384 Species:Rattus norvegicus


Alignment Length:314 Identity:76/314 - (24%)
Similarity:135/314 - (42%) Gaps:57/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETW 123
            :.||    |::|...||..::.||...||:|...||.:.:||..|..::.:.:||....:..:.|
  Rat    47 VYGL----IIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRW 107

  Fly   124 VLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTS--IMKI----LFIWM 182
            :.|.:.|.:..........||::::..::.|||..||:     ||.|:.|  :|||    ..||:
  Rat   108 LFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVR-----PMDIQASHALMKICLKAALIWI 167

  Fly   183 M--------AVFWTVMPLIGWSAYVPEGNLT--ACSIDYMTRMWNPRSYLITYSLFVYYTPLFLI 237
            :        |||..:.|.     :|.:.|.|  :|:....:...:|:.:.:...|..|..||.:|
  Rat   168 VSMLLAIPEAVFSDLHPF-----HVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSII 227

  Fly   238 CYSYWFIIAAVAAHEKAMREQAKKMNV-------KSLRSSEDCDKSAEGKLAKVALTTISLWFMA 295
            ...|:||       .:.:.:.|..:.|       |.:.|.:        :|||..|..:.|:...
  Rat   228 SVYYYFI-------ARNLIQSAYNLPVEGNIHVKKQIESRK--------RLAKTVLVFVGLFAFC 277

  Fly   296 WTPYLVICYFGLF---KIDG--LTPLTTIWGATFAKTSAVYNPIVYGISHPKYR 344
            |.|..||..:..:   ::|.  |..:|:|.....|.|::..||....:....:|
  Rat   278 WLPNHVIYLYRSYHYSEVDTSMLHFITSICARLLAFTNSCVNPFALYLLSKSFR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 48/185 (26%)
7tm_1 74..336 CDD:278431 71/289 (25%)
GrprNP_036838.1 7tm_1 58..321 CDD:278431 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.