DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Pgr15l

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001028533.1 Gene:Pgr15l / 245526 MGIID:2676330 Length:456 Species:Mus musculus


Alignment Length:332 Identity:77/332 - (23%)
Similarity:138/332 - (41%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NPYWSRFAPMDPMMSKILGLFTLA-IMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCM 106
            ||:         :|:||:..|..| |::||..||.:|..:|...|.::....||:.|||.||..:
Mouse    66 NPH---------IMAKIVLTFAYAVIIVISLFGNSLVCQVFVKHKEIKKSTGLLIFNLAISDILI 121

  Fly   107 MASQSPVMIINFYYETWVLGPLWCDI--YAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMT 169
            :...||..:..|....||.|.:.|.:  :|...||.  ||..::..:|.||:.||:.     ||.
Mouse   122 ILLNSPFALARFLSGQWVFGRIMCHVSRFAQYCSLH--VSTLTLMAVAMDRHRVILH-----PMK 179

  Fly   170 IKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMW------NPRSYLITY--- 225
            .:.:..:.||:  :|:.|::...:.....:.:...|..::|..||.:      .|...:..|   
Mouse   180 PRLTHSQCLFV--VAMIWSIAVFLALPHAIYQNLFTLVNMDGDTRSYCLPSFPGPSILVSKYVDL 242

  Fly   226 --SLFVYYTPLFLICYSY-------WF--IIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEG 279
              .:.:|..||.:|..:|       |.  .|...:|.:.....|.:|.:::.|            
Mouse   243 GTFILLYILPLLVIVVTYSHLGKRLWIQNAIGDASARQLMAHYQKRKKSIRML------------ 295

  Fly   280 KLAKVALTTISLWFMAWTP---YLVICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHP 341
                  :..:.::.:.|.|   |:|:......:.|.:......|   ||.:|..|||.:|...:.
Mouse   296 ------ILIVLVFAVCWFPLNFYVVLISSAGVENDSVLFYAFHW---FAMSSTCYNPFIYCWLNR 351

  Fly   342 KYRIVLK 348
            .:|..|:
Mouse   352 SFRAKLR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 47/182 (26%)
7tm_1 74..336 CDD:278431 64/286 (22%)
Pgr15lNP_001028533.1 7tm_4 83..360 CDD:304433 69/306 (23%)
7tm_1 89..346 CDD:278431 64/286 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.