DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and OPN3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_055137.2 Gene:OPN3 / 23596 HGNCID:14007 Length:402 Species:Homo sapiens


Alignment Length:351 Identity:91/351 - (25%)
Similarity:168/351 - (47%) Gaps:44/351 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDMAHLVNPYWSRFAPM-DPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNL 99
            |..|..::|     ||: .|...:.|.|...:|.::....|.:|:.::...:.||||.:||::|:
Human    24 PAPAGTLSP-----APLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNI 83

  Fly   100 AFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAG-CGSLFGCVSIWSMCMIAFDRYNVIVKGI 163
            :.||..:.........::.....||...:.| ::.| .|||||.|||.::.::|::||   ::.:
Human    84 SLSDLLVSLFGVTFTFVSCLRNGWVWDTVGC-VWDGFSGSLFGIVSIATLTVLAYERY---IRVV 144

  Fly   164 NGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLF 228
            :...:....:...|.:||:.::.|...||:||:.|:.:.:...|::|:.::..|..|:::...|.
Human   145 HARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLG 209

  Fly   229 VYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDK-------SAEGKLAKVAL 286
            ....||.:|.:.|..|:                .:::.||..||...       ..|.||||:..
Human   210 CLVVPLGVIAHCYGHIL----------------YSIRMLRCVEDLQTIQVIKILKYEKKLAKMCF 258

  Fly   287 TTISLWFMAWTPYLVICYFGLFKIDG----LTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVL 347
            ..|..:.:.|.||:|||:   ..::|    :||..:|....|||::.||||::|.....|:|..|
Human   259 LMIFTFLVCWMPYIVICF---LVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSL 320

  Fly   348 KEKCPMCV-FGNTDEPKPDAPASDTE 372
            .:.  :|: ......|..|.||:.:|
Human   321 LQL--LCLRLLRCQRPAKDLPAAGSE 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 43/170 (25%)
7tm_1 74..336 CDD:278431 72/273 (26%)
OPN3NP_055137.2 7tmA_Encephalopsin 58..316 CDD:320206 73/280 (26%)
TM helix 2 76..103 CDD:320206 5/26 (19%)
TM helix 3 114..144 CDD:320206 13/33 (39%)
TM helix 4 152..174 CDD:320206 5/21 (24%)
TM helix 5 199..229 CDD:320206 7/45 (16%)
TM helix 6 248..278 CDD:320206 12/32 (38%)
TM helix 7 288..313 CDD:320206 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.