DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and OPN5

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_016865905.1 Gene:OPN5 / 221391 HGNCID:19992 Length:408 Species:Homo sapiens


Alignment Length:323 Identity:95/323 - (29%)
Similarity:151/323 - (46%) Gaps:31/323 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPDMAHLVNPYWSRFAPMDPMMSK-------ILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPA 92
            ||....|  |::.|..  ||..||       :.|.:...|.|:|..|||.|:|:....|....||
Human     8 LPQDERL--PHYLRDG--DPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPA 68

  Fly    93 NLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYN 157
            .::.:|||..|..:.....|..||:.:...||.|.:.|..|...|..|||.|:.:|..::.|||.
Human    69 EIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYL 133

  Fly   158 VIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRS-- 220
            .|.....|..:..|.:.:.:..||..|.|||.|||:|...||||...|:|::|:    |..::  
Human   134 KICYLSYGVWLKRKHAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDW----WLAQASV 194

  Fly   221 ----YLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKL 281
                :::....|....|..:|.:||..|||.|.:..|.:.....:::...:         .|.||
Human   195 GGQVFILNILFFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHV---------LEMKL 250

  Fly   282 AKVALTTISLWFMAWTPYLVICYFGLF-KIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKY 343
            .|||:...:.:.:||.||.|:..:..| :.|.:....::.....||::|:||||:|.:...|:
Human   251 TKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 55/175 (31%)
7tm_1 74..336 CDD:278431 80/268 (30%)
OPN5XP_016865905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.