DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Opn4

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_620215.1 Gene:Opn4 / 192223 RGDID:621701 Length:474 Species:Rattus norvegicus


Alignment Length:363 Identity:126/363 - (34%)
Similarity:182/363 - (50%) Gaps:50/363 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNL 99
            :||.||..                 ||...|.:.:....||..|:|.|...:.||||||:|::||
  Rat    65 VPDHAHYT-----------------LGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINL 112

  Fly   100 AFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGIN 164
            |.|||.|..:|:||...:..|:.|:.|...|..||.||::||.||:.::..||.|||.||.:.:.
  Rat   113 AVSDFLMSFTQAPVFFASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLA 177

  Fly   165 GTPMTIK-TSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLF 228
            ...|..| .:.:.:|.:|:.|:.|::.|..|||||||||.||:||.||:|.....|:|.:....|
  Rat   178 TIGMRSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPLVRAYTMLLFCF 242

  Fly   229 VYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKS-----------AEGKLA 282
            |::.||.:|.:.|.||.       :|:||..        |:.|.|.:|           :|.|:|
  Rat   243 VFFLPLLIIIFCYIFIF-------RAIRETG--------RACEGCGESPLRRRQWQRLQSEWKMA 292

  Fly   283 KVALTTISLWFMAWTPYLVICYFGLFKIDG-LTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIV 346
            ||||..|.|:.::|.||..:...|...... |||..:...|..||.||::|||:|.|:|||||..
  Rat   293 KVALIVILLFVLSWAPYSTVALVGFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRAA 357

  Fly   347 LKEKCP-----MCVFGNTDEPKPDAPASDTETTSEADS 379
            :.:..|     :.|.|....|.....::...|.|...|
  Rat   358 IAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 70/170 (41%)
7tm_1 74..336 CDD:278431 105/274 (38%)
Opn4NP_620215.1 7tm_4 78..>245 CDD:304433 69/166 (42%)
7tm_1 87..347 CDD:278431 105/274 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..474
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349214
Domainoid 1 1.000 186 1.000 Domainoid score I3256
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69152
Inparanoid 1 1.050 210 1.000 Inparanoid score I3580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D389088at33208
OrthoFinder 1 1.000 - - FOG0001799
OrthoInspector 1 1.000 - - otm44480
orthoMCL 1 0.900 - - OOG6_104608
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.