DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and npr-1

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_508816.1 Gene:npr-1 / 180752 WormBaseID:WBGene00003807 Length:457 Species:Caenorhabditis elegans


Alignment Length:391 Identity:101/391 - (25%)
Similarity:172/391 - (43%) Gaps:87/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLN 98
            |.||      |..|.:| :.|.::..|.||.|.:.     ||..::|:....|:|.:..|:.:||
 Worm    15 VYPD------PSQSIYA-IVPFLTVYLFLFFLGLF-----GNVTLIYVTCSHKALLSVQNIFILN 67

  Fly    99 LAFSDFCMMASQS-PVMIINFYYETWVLGPLWCDIYAGC--G-SLFGCVSIWSMCMIAFDRYNVI 159
            ||.|| |||...| |:..|...|:.|..|.|.|.:.. |  | |:|.|.  :|:..||.|||.::
 Worm    68 LAASD-CMMCILSLPITPITNVYKNWYFGNLLCHLIP-CIQGISIFVCT--FSLGAIALDRYILV 128

  Fly   160 VKGINGTPMTIKTSIMKILFIWMMAVFWTV-----MPLIGWSAYVPEGNLTACSIDYMTRMW--- 216
            |:. :.||::.:.:.:..:.:|:::...|:     |.:|   .|..|   ..|.. :.|..|   
 Worm   129 VRP-HSTPLSQRGAFLTTVLLWILSFVVTLPYAFNMQMI---EYTEE---RICGY-FCTEKWESA 185

  Fly   217 -NPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKM--NVKSLRSS-------- 270
             :.|:|.:...|..:..|..::.:.|..|::.::   |..:.:.:||  ...:|.||        
 Worm   186 KSRRAYTMIVMLAQFVVPFAVMAFCYANIVSVLS---KRAQTKIRKMVERTSALESSCAFPSHGL 247

  Fly   271 --------EDCDKSAEGKLAKV--------ALTTISLWF-MAWTPYLVI----------CYFGLF 308
                    |..||..:.|...|        .|.|:.:|| :.|.|:.||          .:|.|:
 Worm   248 EQYENELNEFLDKQEKEKQRVVLQNRRTTSILVTMVVWFGITWLPHNVISLIIEYDDTQSFFRLY 312

  Fly   309 KID--GLTPLTTIWGATFAKTSAVYNPIVYGISHPKYR-IVLKEKCPMCVFGNTDEPKPDAPASD 370
            ..|  .::.|..::..:.|.::.|.||::|...:|.:| :|:|     ..||  |..|.|...:.
 Worm   313 GRDDYDISYLLNLFTHSIAMSNNVLNPVLYAWLNPSFRQLVIK-----TYFG--DRRKSDRIINQ 370

  Fly   371 T 371
            |
 Worm   371 T 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 50/182 (27%)
7tm_1 74..336 CDD:278431 79/313 (25%)
npr-1NP_508816.1 7tmA_NPYR-like 27..351 CDD:320331 86/343 (25%)
TM helix 1 29..53 CDD:320331 7/28 (25%)
TM helix 2 62..84 CDD:320331 12/22 (55%)
TM helix 3 100..122 CDD:320331 7/24 (29%)
TM helix 4 143..159 CDD:320331 2/15 (13%)
TM helix 5 189..212 CDD:320331 4/22 (18%)
TM helix 6 273..298 CDD:320331 8/24 (33%)
TM helix 7 321..346 CDD:320331 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6646
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.