DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Grpr

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_032203.1 Gene:Grpr / 14829 MGIID:95836 Length:384 Species:Mus musculus


Alignment Length:337 Identity:80/337 - (23%)
Similarity:142/337 - (42%) Gaps:63/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLA 100
            |.|.:..:|.:....|      .:.||    |::|...||..::.||...||:|...||.:.:||
Mouse    30 PKMDNWFHPGFIYVIP------AVYGL----IIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLA 84

  Fly   101 FSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGING 165
            ..|..::.:.:||....:..:.|:.|.:.|.:..........||::::..::.|||..||:    
Mouse    85 LGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVR---- 145

  Fly   166 TPMTIKTS--IMKI----LFIWMM--------AVFWTVMPLIGWSAYVPEGNLT--ACSIDYMTR 214
             ||.|:.|  :|||    ..||::        |||..:.|.     :|.:.|.|  :|:....:.
Mouse   146 -PMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPF-----HVKDTNQTFISCAPYPHSN 204

  Fly   215 MWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNV-------KSLRSSED 272
            ..:|:.:.:...|..|..||.:|...|:||       .:.:.:.|..:.|       |.:.|.: 
Mouse   205 ELHPKIHSMASFLVFYVIPLAIISVYYYFI-------ARNLIQSAYNLPVEGNIHVKKQIESRK- 261

  Fly   273 CDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLF---KIDG--LTPLTTIWGATFAKTSAVYN 332
                   :|||..|..:.|:...|.|..||..:..:   ::|.  |..:|:|.....|.|::..|
Mouse   262 -------RLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVN 319

  Fly   333 PIVYGISHPKYR 344
            |....:....:|
Mouse   320 PFALYLLSKSFR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 48/185 (26%)
7tm_1 74..336 CDD:278431 71/289 (25%)
GrprNP_032203.1 7tm_1 58..321 CDD:278431 70/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.