DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Opn1mw

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_032132.1 Gene:Opn1mw / 14539 MGIID:1097692 Length:359 Species:Mus musculus


Alignment Length:382 Identity:97/382 - (25%)
Similarity:162/382 - (42%) Gaps:67/382 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SHLPETPFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIM 68
            |:..:.||:    ||.:.                    :.|.|         :..:...:.:.::
Mouse    28 SNSTKGPFE----GPNYH--------------------IAPRW---------VYHLTSTWMILVV 59

  Fly    69 IISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIY 133
            :.|...||:|:......|.||.|.|.:::|||.:|.......|.:.::|..|..:|||...|.|.
Mouse    60 VASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPLCVIE 124

  Fly   134 AGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAY 198
            ....||.|...:||:.:|:::|:.|:.|.........|.:.:.|:|.|:.|..||..|:.|||.|
Mouse   125 GYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAIWTAPPIFGWSRY 189

  Fly   199 VPEGNLTACSIDYMTRMWNP--RSYLITYSLFVYYTPLFLI--CY-SYWFIIAAVAAHEKAMREQ 258
            .|.|..|:|..|..:....|  :||::...:.....||.:|  || ..|..|.|||..:|     
Mouse   190 WPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLAIRAVAKQQK----- 249

  Fly   259 AKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKID----GLTPLTTI 319
                      .||...| ||.::.::.:..:..:.:.|.||   .:|..|...    ...||...
Mouse   250 ----------ESESTQK-AEKEVTRMVVVMVFAYCLCWGPY---TFFACFATAHPGYAFHPLVAS 300

  Fly   320 WGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFG-NTDEPKPDAPASDTETTS 375
            ..:.|||::.:||||:|...:.::|     .|.:.:|| ..|:....:..|.||.:|
Mouse   301 LPSYFAKSATIYNPIIYVFMNRQFR-----NCILHLFGKKVDDSSELSSTSKTEVSS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 52/171 (30%)
7tm_1 74..336 CDD:278431 79/270 (29%)
Opn1mwNP_032132.1 Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 12..38 3/13 (23%)
7tm_1 66..317 CDD:278431 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.