DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and GPR151

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_919227.2 Gene:GPR151 / 134391 HGNCID:23624 Length:419 Species:Homo sapiens


Alignment Length:409 Identity:90/409 - (22%)
Similarity:151/409 - (36%) Gaps:110/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPM-MSKILGLFTLAIMIISCCGNGVVVYIF--G 83
            |.:..|.|.: ||  ..|||  .:...:.|.|.. ...|:....:|:.::...||..|:.|.  .
Human     5 AFADSNSSSM-NV--SFAHL--HFAGGYLPSDSQDWRTIIPALLVAVCLVGFVGNLCVIGILLHN 64

  Fly    84 GTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSI-WS 147
            ..|...:..:.|:|||:.:|..::...:|:....:....|.||  |          |.|.|. |.
Human    65 AWKGKPSMIHSLILNLSLADLSLLLFSAPIRATAYSKSVWDLG--W----------FVCKSSDWF 117

  Fly   148 M--CMIAFDRYNVIVKGINGTPMTIKTSIMKILF----------------IW-MMAVFWTV---M 190
            :  ||.|.....|:|              .|:.|                || ::...|||   :
Human   118 IHTCMAAKSLTIVVV--------------AKVCFMYASDPAKQVSIHNYTIWSVLVAIWTVASLL 168

  Fly   191 PLIGW--SAYVPEGNLTACSID-------YMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIA 246
            ||..|  |.......:..|.:|       :|:....      .|.|..:..|||...:.:|    
Human   169 PLPEWFFSTIRHHEGVEMCLVDVPAVAEEFMSMFGK------LYPLLAFGLPLFFASFYFW---- 223

  Fly   247 AVAAHEKAMREQAKKMNVKS-LRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYF---GL 307
              .|:::..:...|..|::: :||     |.....|..:|:.:..||...|..:|.:.:.   |.
Human   224 --RAYDQCKKRGTKTQNLRNQIRS-----KQVTVMLLSIAIISALLWLPEWVAWLWVWHLKAAGP 281

  Fly   308 FKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLK-------EKCPMCV-------FGN 358
            ....|...|:.:  ..|:.:||  ||:::.:...::|..||       .|.|..|       .||
Human   282 APPQGFIALSQV--LMFSISSA--NPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGN 342

  Fly   359 TD-----EPKPDAPASDTE 372
            ::     .|.|::|||..|
Human   343 SEGLPDKVPSPESPASIPE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 43/203 (21%)
7tm_1 74..336 CDD:278431 64/299 (21%)
GPR151NP_919227.2 7tmA_GPR151 38..317 CDD:320133 67/325 (21%)
TM helix 1 38..64 CDD:320133 6/25 (24%)
TM helix 2 73..98 CDD:320133 6/24 (25%)
TM helix 3 110..140 CDD:320133 10/43 (23%)
TM helix 4 153..174 CDD:320133 7/20 (35%)
TM helix 5 199..228 CDD:320133 8/40 (20%)
TM helix 6 243..273 CDD:320133 9/34 (26%)
TM helix 7 285..310 CDD:320133 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 330..419 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.