DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Brs3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_033896.2 Gene:Brs3 / 12209 MGIID:1100501 Length:399 Species:Mus musculus


Alignment Length:325 Identity:70/325 - (21%)
Similarity:148/325 - (45%) Gaps:38/325 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCD 131
            |:.:...||.:::.:|..|||::|..|:.:.:|||.|..::.:..||...::..|.|:.|.:.|.
Mouse    57 IISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCK 121

  Fly   132 IYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGI-NGTPMTIKTSIMKILFIWMMAVFWTVMPLIGW 195
            :.:........||::::.:::.|||..:||.: ...|..|..:..|...||::::.:.:...|..
Mouse   122 VLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPPNAILKTCAKAGGIWIVSMIFALPEAIFS 186

  Fly   196 SAYV---PEGNLT--AC-SIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKA 254
            :.|.   |..|:|  :| |.....|:......|:.:.:| |..||.:|  |.::.:.|...::..
Mouse   187 NVYTFQDPNRNVTFESCNSYPISERLLQEIHSLLCFLVF-YIIPLSII--SVYYSLIARTLYKST 248

  Fly   255 M----REQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDGLTP 315
            :    .||:...  |.:.|.:        ::||..|..::|:.:.|.|..::..:..|..:....
Mouse   249 LNIPTEEQSHAR--KQIESRK--------RIAKTVLVLVALFALCWLPNHLLYLYHSFTYESYAN 303

  Fly   316 ------LTTIWGATFAKTSAVYNPI-VYGISHPKYRIVLKEKCPMCVFGNTDEPKP---DAPASD 370
                  :..|:....|.:::..||. :|.:|....:....:.|  |:  ..::|:|   |.|.::
Mouse   304 HSDVPFVIIIFSRVLAFSNSCVNPFALYWLSKTFQQHFKAQLC--CL--KAEQPEPPLGDIPLNN 364

  Fly   371  370
            Mouse   365  364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 44/176 (25%)
7tm_1 74..336 CDD:278431 61/279 (22%)
Brs3NP_033896.2 7tm_1 64..328 CDD:278431 60/276 (22%)
7tm_4 <137..347 CDD:304433 44/224 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.