DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and Opn1sw

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_031564.1 Gene:Opn1sw / 12057 MGIID:99438 Length:346 Species:Mus musculus


Alignment Length:381 Identity:96/381 - (25%)
Similarity:164/381 - (43%) Gaps:66/381 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCG 74
            |:|    ||::                   ||. |.|:         .::...|...:..:....
Mouse    18 PWD----GPQY-------------------HLA-PVWA---------FRLQAAFMGFVFFVGTPL 49

  Fly    75 NGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSL 139
            |.:|:......|.||.|.|.:::|::...|.........:.|...:..::.|...|.:.|..||:
Mouse    50 NAIVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSV 114

  Fly   140 FGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNL 204
            .|.|:.||:..:||:||.||.|.........|.::|.:|..|::.:..::.|..|||.::|||..
Mouse   115 AGLVTGWSLAFLAFERYVVICKPFGSIRFNSKHALMVVLATWIIGIGVSIPPFFGWSRFIPEGLQ 179

  Fly   205 TACSIDYMTRMWNPRSYLITYSLFV--YYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSL 267
            .:|..|:.|.....||...|:.||:  :..||.|||:||..::..:.|.....:|.|        
Mouse   180 CSCGPDWYTVGTKYRSEYYTWFLFIFCFIIPLSLICFSYSQLLRTLRAVAAQQQESA-------- 236

  Fly   268 RSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVIC-YFGLFKIDGL-TPLTTIWGATFAKTSAV 330
                 ..:.||.:::.:.:..:..:.:.:.||..:. |....:..|| ..|.|| .|.|:|:|.|
Mouse   237 -----TTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLDLRLVTI-PAFFSKSSCV 295

  Fly   331 YNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASD------TETTSEADSK 380
            ||||:|...:.::|..:.|.  :|       .||.|..||      ||.::.:.||
Mouse   296 YNPIIYCFMNKQFRACILEM--VC-------RKPMADESDVSGSQKTEVSTVSSSK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 47/171 (27%)
7tm_1 74..336 CDD:278431 74/265 (28%)
Opn1swNP_031564.1 7tm_4 38..319 CDD:304433 79/303 (26%)
7tm_1 50..301 CDD:278431 74/264 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..346 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.