DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and tmtops3a

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001269303.1 Gene:tmtops3a / 102031125 ZFINID:ZDB-GENE-130828-1 Length:379 Species:Danio rerio


Alignment Length:361 Identity:96/361 - (26%)
Similarity:173/361 - (47%) Gaps:44/361 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSK----ILGLFTLAIMIISCCGNGVVVYIFGGT 85
            |||.|..|        |:.|:.|     .|.:|:    :..:...||:::.|..|..|:.:|...
Zfish    21 SGNVSSGD--------LLEPHDS-----PPGLSRTGHTVTAVCLGAILLLGCLNNLFVLLVFARF 72

  Fly    86 KSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCM 150
            :||.||.||::||::.||..:....:|....:..|..|:||...|..|....||||.||:.|:.:
Zfish    73 RSLWTPINLILLNISVSDILVCLFGTPFSFASSLYGKWLLGHHGCKWYGFANSLFGIVSLMSLSI 137

  Fly   151 IAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRM 215
            ::::||..:::.........:.:.:.:...|:.::.||:.|.:|||.|.|||..|.||:.:..|.
Zfish   138 LSYERYAALLRATKADVSDFRRAWLCVAGSWLYSLLWTLPPFLGWSNYGPEGPGTTCSVQWHLRS 202

  Fly   216 WNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGK 280
            .:..||::...:|....||.|:.:.|..|:..:        :...|:|:.:.:..|:       .
Zfish   203 TSSISYVMCLFIFCLLLPLVLMIFCYGKILLLI--------KGVTKINLLTAQRREN-------H 252

  Fly   281 LAKVALTTISLWFMAWTPYLVICYFGLFKIDGL-TPLTTIWGATFAKTSAVYNPIVYGI-SHPKY 343
            :..:.:|.:|.:.:.|.||.|:.....|...|| ||:|:|..:..||:|.|.||::|.: ::..|
Zfish   253 ILLMVVTMVSCYLLCWMPYGVVALLATFGRTGLITPVTSIVPSVLAKSSTVVNPVIYVLFNNQFY 317

  Fly   344 R-IVLKEKCPMCVFGNTDEPKPDAPASDTETTSEAD 378
            | .|...||         :.:|.....:.:.:|:.|
Zfish   318 RCFVAFLKC---------QGEPSVHGQNPQHSSKED 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 51/169 (30%)
7tm_1 74..336 CDD:278431 74/262 (28%)
tmtops3aNP_001269303.1 7tm_1 62..309 CDD:278431 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.