DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and OPN1MW3

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001316996.1 Gene:OPN1MW3 / 101060233 HGNCID:51831 Length:364 Species:Homo sapiens


Alignment Length:376 Identity:101/376 - (26%)
Similarity:160/376 - (42%) Gaps:67/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCG 74
            ||:    ||.:            ::.|...:.:...|..|                 ::|.|...
Human    39 PFE----GPNY------------HIAPRWVYHLTSVWMIF-----------------VVIASVFT 70

  Fly    75 NGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSL 139
            ||:|:......|.||.|.|.:::|||.:|.......|.:.::|..|..:|||...|.:.....||
Human    71 NGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSL 135

  Fly   140 FGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNL 204
            .|...:||:.:|:::|:.|:.|.........|.:|:.|.|.|:.|..||..|:.|||.|.|.|..
Human   136 CGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLK 200

  Fly   205 TACSIDYMTRMWNP--RSYLITYSLFVYYTPLFLI--CY-SYWFIIAAVAAHEKAMREQAKKMNV 264
            |:|..|..:....|  :||:|...:....|||.:|  || ..|..|.|||..:|           
Human   201 TSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQK----------- 254

  Fly   265 KSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDG----LTPLTTIWGATFA 325
                .||...| ||.::.::.:..:..:...|.||   .:|..|....    ..||.....|.||
Human   255 ----ESESTQK-AEKEVTRMVVVMVLAFCFCWGPY---AFFACFAAANPGYPFHPLMAALPAFFA 311

  Fly   326 KTSAVYNPIVYGISHPKYRIVLKEKCPMCVFG-NTDEPKPDAPASDTETTS 375
            |::.:|||::|...:.::|     .|.:.:|| ..|:....:.||.||.:|
Human   312 KSATIYNPVIYVFMNRQFR-----NCILQLFGKKVDDGSELSSASKTEVSS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 55/171 (32%)
7tm_1 74..336 CDD:278431 81/270 (30%)
OPN1MW3NP_001316996.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000250|UniProtKB:P04001 17..43 2/7 (29%)
7tm_4 61..>178 CDD:304433 35/133 (26%)
7tm_1 71..322 CDD:278431 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.