DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn5

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_002936036.1 Gene:opn5 / 100497642 XenbaseID:XB-GENE-1018909 Length:343 Species:Xenopus tropicalis


Alignment Length:317 Identity:90/317 - (28%)
Similarity:152/317 - (47%) Gaps:21/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PYWSRFAPMDPMMSKI-------LGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAF 101
            |::.|  ..||..||:       .|::.:||.|:|..|||.|:|:....|....||.::.:|||.
 Frog    15 PHYER--DSDPFASKLSREADIFAGVYLMAIGILSTLGNGYVIYMACSRKKKLRPAEIMTINLAV 77

  Fly   102 SDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGT 166
            .|..:..:..|..|::.:...||.|...|..|...|..|||.|:.::.:::.|||..|.....||
 Frog    78 CDLGISVTGKPFAIVSCFSHRWVFGWNACRWYGWAGFFFGCGSLITLTVVSLDRYLKICHLRYGT 142

  Fly   167 PMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSL--FV 229
            .:..:.:.:.:..||..|..|..:||:|...|.||...|.|::|:.....:.:..:...|:  |.
 Frog   143 WLKRRHAFIALAVIWAYATLWATLPLVGVGNYAPEPFGTTCTLDWWLAQASVKGQIFVLSMLFFC 207

  Fly   230 YYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFM 294
            ...|..:|.:||..|||.|       :..||::.....|:..  :.:.|.||.|||:...:.:.:
 Frog   208 LLFPTMVIVFSYAKIIAKV-------KSSAKEVAHFDTRNQN--NHTLEIKLTKVAMLICAGFLI 263

  Fly   295 AWTPYLVICYFGLF-KIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEK 350
            ||.||.|:..:..| :.|.:....::.....||::::||||:|.:...|.....|:|
 Frog   264 AWFPYAVVSVWSAFGQPDSIPIELSVVPTMMAKSASMYNPIIYQVIDCKPACCKKDK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 49/171 (29%)
7tm_1 74..336 CDD:278431 75/264 (28%)
opn5XP_002936036.1 7tm_1 50..306 CDD:278431 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.