DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and tmtops

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001304832.1 Gene:tmtops / 100488877 XenbaseID:XB-GENE-1018915 Length:382 Species:Xenopus tropicalis


Alignment Length:271 Identity:77/271 - (28%)
Similarity:141/271 - (52%) Gaps:15/271 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCD 131
            |:::....|..|:.||....::|||.|:::||::.||..:....:|...::.....|:||...|.
 Frog    46 ILVLGSLYNSFVLLIFVKFTAIRTPINMILLNISVSDLLVCIFGTPFSFVSSVSGGWLLGQQGCK 110

  Fly   132 IYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWS 196
            .|..|.||||.||:.|:.|::::||..::|.........|.|.:.|:..|:.::.||:.||||||
 Frog   111 WYGFCNSLFGLVSMISLSMLSYERYLTVLKCTKADMTDYKKSWLCIIVSWLYSLCWTLPPLIGWS 175

  Fly   197 AYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKK 261
            :|..|.:.|.||:.:.::..|..||::...||....|||::.:.|..|:       :.:|.|..:
 Frog   176 SYGLESSGTTCSVVWHSKSSNNISYIVCLFLFCLVLPLFIMIFCYGHIV-------RVIRGQVCR 233

  Fly   262 MNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDG-LTPLTTIWGATFA 325
            :|:.:.:..|.       :|..:.:..::.:.:.|.||.::.....|...| :||..:|..:..|
 Frog   234 INMTTAQKREH-------RLLFMVVCMVTCYLLCWMPYGLVSLMTAFGKPGMITPTVSIIPSILA 291

  Fly   326 KTSAVYNPIVY 336
            |:|...||::|
 Frog   292 KSSTFINPLIY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 56/169 (33%)
7tm_1 74..336 CDD:278431 75/262 (29%)
tmtopsNP_001304832.1 7tm_1 54..302 CDD:278431 75/261 (29%)
7tm_4 <119..319 CDD:304433 55/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.