DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and XB5817984

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:XP_002937272.2 Gene:XB5817984 / 100485989 XenbaseID:XB-GENE-5817985 Length:363 Species:Xenopus tropicalis


Alignment Length:362 Identity:94/362 - (25%)
Similarity:159/362 - (43%) Gaps:48/362 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NGSVLDNVLPDMAHLVNP--YWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLR 89
            |.|.|...|....||..|  :.|..|.|  :.:.|.| |.|.::.|.|...         .|.||
 Frog    27 NISSLSPFLVPQTHLGTPGIFMSISAFM--LFTIIFG-FPLNLLTIICTAK---------YKKLR 79

  Fly    90 TPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFD 154
            :..|.:::|||.::..::...|.....:|....:.:|.|.|.|.....:|.|.:.:||:.::||:
 Frog    80 SHLNYILVNLAVANLIVICFGSTTAFYSFSQMYFSMGTLACKIEGFTATLGGIIGLWSLAVVAFE 144

  Fly   155 RYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMT--RMWN 217
            |:.||.|.:.........:::..:..|:|.:.....||:|||.|:|||...:|..|:.|  ..||
 Frog   145 RFLVICKPMGSFTFRESHAVLGCILTWVMGLLAATPPLLGWSRYIPEGLQCSCGPDWYTVNNKWN 209

  Fly   218 PRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLA 282
            ..||:|....|.:..||.:|.:||..::..:.|..|...:.|             ..:.||.::.
 Frog   210 NESYVIFLFCFCFGFPLAIIVFSYGRLLLTLHAVAKQQEQSA-------------TTQKAEREVT 261

  Fly   283 KVALTTISLWFMAWTPYLVICYFGLFKIDGLTPLTTIWGAT----FAKTSAVYNPIVYGISHPKY 343
            ::.:..::.:.:.|.||   ..|.|:.:.....|..:..|:    |:|.|.||||.:|...:.::
 Frog   262 RMVIVMVAGFLVCWLPY---ASFALWSVTHRGELFDLRMASIPSVFSKASTVYNPFIYIFMNRQF 323

  Fly   344 RIVLKEKCPM-CVFGNTDEPKPDAPASDTETTSEADS 379
            |     .|.| .:|...:      |..|.|.||.:.|
 Frog   324 R-----SCMMKMIFCGKN------PLGDDEETSVSGS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 47/171 (27%)
7tm_1 74..336 CDD:278431 67/267 (25%)
XB5817984XP_002937272.2 7tm_4 55..333 CDD:304433 77/308 (25%)
7tm_1 65..316 CDD:278431 69/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.