DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and tmtops2b

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001269302.1 Gene:tmtops2b / 100331536 ZFINID:ZDB-GENE-110411-43 Length:368 Species:Danio rerio


Alignment Length:315 Identity:85/315 - (26%)
Similarity:153/315 - (48%) Gaps:29/315 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DMAHLVNPYWSRFAPMDPM-------MSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANL 94
            |...|::..||. :||:.:       :|..||.    ||......|.||:.:|...|:||||.|:
Zfish     5 DRLTLLDEDWSD-SPMETLSRAGFIALSVFLGF----IMTFGFFNNLVVLVLFCKFKTLRTPVNM 64

  Fly    95 LVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVI 159
            |:||::.||..:....:.:...:.....|:||...|..|....|.||.||:.|:.::::|||:.:
Zfish    65 LLLNISISDMLVCMFGTTLSFASSVRGRWLLGRHGCMWYGFINSCFGIVSLISLVVLSYDRYSTL 129

  Fly   160 VKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLIT 224
            .......| ..:..::.:...|:.::.|||.||:|||:|..||..|:||:.:..|.....:|:|.
Zfish   130 TVYHKRAP-DYRKPLLAVGGSWLYSLIWTVPPLLGWSSYGLEGAGTSCSVSWTQRTAESHAYIIC 193

  Fly   225 YSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTI 289
            ..:|....|:.::.|.|..::.||....|..:..|:|               .|..:..:.:||:
Zfish   194 LFVFCLGLPVLVMVYCYGRLLYAVKQVGKIRKTAARK---------------REYHVLFMVITTV 243

  Fly   290 SLWFMAWTPYLVICYFGLFKIDG-LTPLTTIWGATFAKTSAVYNPIVYGISHPKY 343
            ..:.:.|.||.|:.....|...| ::|:.::..:..||:|.|.||::|.:.:.::
Zfish   244 VCYLLCWMPYGVVAMMATFGRPGIISPVASVVPSLLAKSSTVINPLIYILMNKQF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 52/169 (31%)
7tm_1 74..336 CDD:278431 73/262 (28%)
tmtops2bNP_001269302.1 7tm_4 36..>78 CDD:304433 17/45 (38%)
7tm_1 45..291 CDD:278431 73/261 (28%)
ALDH-SF 215..>288 CDD:299846 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.