DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh2 and opn8a

DIOPT Version :9

Sequence 1:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001303876.1 Gene:opn8a / 100002138 ZFINID:ZDB-GENE-151029-1 Length:335 Species:Danio rerio


Alignment Length:346 Identity:92/346 - (26%)
Similarity:157/346 - (45%) Gaps:37/346 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMII 116
            :.|.:....|.|.|.|.|:|..||..|:.......|:.....||.:|||.:|..|..|..|:.|.
Zfish     8 LSPAVDYSAGTFLLVIAILSILGNAAVLLTAAWRHSVLKAPELLTVNLAVTDIGMALSMYPLSIA 72

  Fly   117 NFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKG---INGTPMTIKTSIMKIL 178
            :.:...|:.|...|..|...|.:|...||.::.::...||  :|.|   .:|:....||..:.|.
Zfish    73 SAFNHAWIGGDPSCLYYGLMGMIFSVASIMTLAVMGLVRY--LVTGNPPKSGSKFRRKTISILIG 135

  Fly   179 FIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYM--TRMWNPRSYLITYSLFVYYTPLFLICYSY 241
            .|||.::.|.|.|::||..|.||....|||:|:|  ....|..|:::..::.....|..:|.:||
Zfish   136 VIWMYSLLWAVFPILGWGGYGPEPFGLACSVDWMGYQHSLNRSSFIMALAILCTLMPCVVILFSY 200

  Fly   242 ----WFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKS--AEGKLAKVALTTISLWFMAWTPYL 300
                |.:..|                .:|::|:::...|  .|.|:..:.:...:.:.::|.||:
Zfish   201 SGIAWKLHKA----------------YQSIQSNDNLPNSGAVERKVTLMGILISTGFIVSWAPYV 249

  Fly   301 VICYFGLFKIDG---LTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDE- 361
            .:..:.:|:.:|   :.|:.::....|||.|.||||:||.:....:|..:.:....|..|..|. 
Zfish   250 FVSLWTMFRSEGEDSVVPIVSLLPCLFAKCSTVYNPLVYYVFRKSFRREIHQIRICCFQGCWDAV 314

  Fly   362 ---PKPDAPASDTETTSEADS 379
               .:.|.| .:|..|.|.|:
Zfish   315 SKMTRGDGP-EETSGTHETDN 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 52/174 (30%)
7tm_1 74..336 CDD:278431 73/275 (27%)
opn8aNP_001303876.1 7tm_4 21..>219 CDD:304433 60/215 (28%)
7tm_1 30..288 CDD:278431 73/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.