DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and WFDC8

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:57 Identity:22/57 - (38%)
Similarity:31/57 - (54%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CYVGRNEGNFCSRKDQTKVVTRWYFD-KGV-CKPFNYKGCNGNRNRFCSQESCDARC 109
            |.:....|| |:.:.|     ||:|| |.. |.||.|:||.||.|.|.::::|...|
Human    95 CMLPVRHGN-CNHEAQ-----RWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTAC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 16/36 (44%)
WFDC8XP_016883608.1 WAP 47..90 CDD:459672
KU 93..145 CDD:197529 21/55 (38%)
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.