DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and Spint5

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001035144.1 Gene:Spint5 / 641368 MGIID:3651687 Length:105 Species:Mus musculus


Alignment Length:48 Identity:18/48 - (37%)
Similarity:26/48 - (54%) Gaps:7/48 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FCSRKDQTKVVTRWYF--DKGVCKPFNYKGCNGNRNRFCSQESCDARC 109
            |||     ....|:||  :..:|:.|.:.||.||||.|.::..|:.||
Mouse    57 FCS-----FTFYRYYFNPESALCESFIFTGCGGNRNNFKTKYLCEVRC 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/36 (36%)
Spint5NP_001035144.1 Kunitz-type 49..99 CDD:438633 16/46 (35%)

Return to query results.
Submit another query.