DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and col28a1a

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:35 Identity:15/35 - (42%)
Similarity:20/35 - (57%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARC 109
            ||:|  ...|..|.|.||.||.|||.:::.|.:.|
Zfish  1133 WYYDPQANACAQFWYGGCQGNSNRFETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/33 (42%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 14/33 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.