DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and ambp

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:91 Identity:30/91 - (32%)
Similarity:42/91 - (46%) Gaps:23/91 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NGAVVSCKELNNFNCYVGRNEGNFCSRKD-----QTKVVTRWYFDKGVCKPF------------- 87
            |.:::|| ::..|...:| |:.||.:.||     :|:...|...|.|.||.|             
Zfish   244 NSSIMSC-QMFTFGGCMG-NQNNFPTEKDCLQSCRTEAACRLPMDAGPCKAFVDLWAFDSSSGKC 306

  Fly    88 ---NYKGCNGNRNRFCSQESCDARCG 110
               .|.||.||.|||.|::.||..||
Zfish   307 LSLKYGGCKGNGNRFYSKKECDEYCG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 17/50 (34%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 10/33 (30%)
Kunitz_bikunin_2-like 278..332 CDD:438640 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.