DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and K12G11.6

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001024057.2 Gene:K12G11.6 / 3565780 WormBaseID:WBGene00010792 Length:186 Species:Caenorhabditis elegans


Alignment Length:68 Identity:26/68 - (38%)
Similarity:35/68 - (51%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VVSCKELNNFNCYVGRNEGNFCSRKDQTKVVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCD 106
            :|.|....:.:|....|.|:....|.|..:  ::||||  .:|.||.|.||.||.|||...|.|:
 Worm     9 IVLCLFSLSHSCQDPPNRGHTKCGKAQKSI--KYYFDKKLEMCLPFLYSGCGGNTNRFDDSEMCN 71

  Fly   107 ARC 109
            .||
 Worm    72 LRC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 17/36 (47%)
K12G11.6NP_001024057.2 KU 20..74 CDD:197529 22/55 (40%)

Return to query results.
Submit another query.