DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and COL28A1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:57 Identity:23/57 - (40%)
Similarity:29/57 - (50%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CYVGRNEGNFCSRKDQTKVVTRWYFDKGV--CKPFNYKGCNGNRNRFCSQESCDARC 109
            |......|| |.     :.|.|||:||.|  |..|.:.||||:.|||.|::.|...|
Human  1072 CLEALKPGN-CG-----EYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQETC 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 18/36 (50%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066
Kunitz-type 1072..1122 CDD:444694 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.