DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and CG16713

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:38 Identity:16/38 - (42%)
Similarity:22/38 - (57%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VTRWYF--DKGVCKPFNYKGCNGNRNRFCSQESCDARC 109
            :..|.:  |:..|..|.|.||.||.|||.|:|.|:.:|
  Fly    43 IPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 15/36 (42%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 15/36 (42%)

Return to query results.
Submit another query.