DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and Col28a1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:66 Identity:25/66 - (37%)
Similarity:33/66 - (50%) Gaps:18/66 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CKE-LNNFNCYVGRNEGNFCSRKDQTKVVTRWYFDKGV--CKPFNYKGCNGNRNRFCSQESCDAR 108
            |:| |...||      |::         |.|||:||.|  |..|.:.||||:.|||.|::.|...
  Rat  1088 CEEALKPGNC------GDY---------VVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQET 1137

  Fly   109 C 109
            |
  Rat  1138 C 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 18/36 (50%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.