DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and Spint1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:57 Identity:21/57 - (36%)
Similarity:29/57 - (50%) Gaps:12/57 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VGRNEGNFCSRKDQTKVVTRWYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARCGD 111
            |||..|:|          .|||:|  :.:||.|.:.||.||:|.:..:|.|...|.|
  Rat   250 VGRCRGSF----------PRWYYDPKEQICKSFTFGGCLGNKNNYLREEECMLACKD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/36 (39%)
Spint1NP_001004265.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666 21/57 (37%)
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.