| Sequence 1: | NP_650755.1 | Gene: | CG14298 / 42259 | FlyBaseID: | FBgn0038654 | Length: | 111 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_008760202.1 | Gene: | Tfpi / 29436 | RGDID: | 61914 | Length: | 306 | Species: | Rattus norvegicus |
| Alignment Length: | 51 | Identity: | 16/51 - (31%) |
|---|---|---|---|
| Similarity: | 27/51 - (52%) | Gaps: | 7/51 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 61 EGNFCSRKDQTKVVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCDARC 109 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14298 | NP_650755.1 | Kunitz-type | <74..109 | CDD:438633 | 14/36 (39%) |
| Tfpi | XP_008760202.1 | Kunitz_TFPI1_1-like | 50..104 | CDD:438656 | |
| Kunitz_TFPI1_2-like | 120..175 | CDD:438657 | |||
| Kunitz_TFPI1_TFPI2_3-like | 223..276 | CDD:438658 | 15/49 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||