DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and Tfpi

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:51 Identity:16/51 - (31%)
Similarity:27/51 - (52%) Gaps:7/51 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EGNFCSRKDQTKVVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCDARC 109
            :...|...::     |:|::.  |.|:.|||.||.||.|.|.:::.|:..|
  Rat   231 DSGLCKASEK-----RFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRAC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/36 (39%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656
Kunitz_TFPI1_2-like 120..175 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.