DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:65 Identity:18/65 - (27%)
Similarity:30/65 - (46%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CKELNNFNCYVGRNEGNFCSRKDQTKVVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCDARC 109
            |.:|....|.:.::.|...:      .:.||::::  .:|..|.|.||.||.|.|.|:..|...|
Mouse   126 CMDLRQDVCSLPQDPGPCLA------YLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVC 184

  Fly   110  109
            Mouse   185  184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/36 (36%)
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672 1/1 (100%)
Kunitz_eppin 132..188 CDD:438654 16/59 (27%)

Return to query results.
Submit another query.