DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and W05B2.2

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:70 Identity:22/70 - (31%)
Similarity:29/70 - (41%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GAVVSCKELNNFNCYVGRNEGNFCSRKDQTKVVTRWYFD--KGVCKPFNYKGCNGNRNRFCSQES 104
            |.:.:|.......|..|...|..|.    ...:.|||:|  ...|..|.|:|||||.|.|.::..
 Worm   495 GTMHACCPSRELTCNQGLQVGTTCG----LSTLQRWYYDPLHNRCNQFEYQGCNGNDNNFVTRVD 555

  Fly   105 CDARC 109
            |...|
 Worm   556 CIETC 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 15/36 (42%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636 19/55 (35%)
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.