DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and K11D12.6

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:36 Identity:16/36 - (44%)
Similarity:19/36 - (52%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RWYFDKGV--CKPFNYKGCNGNRNRFCSQESCDARC 109
            |:::|..|  |.||.|.||.||.|.|.....|..||
 Worm    37 RYHYDPTVKRCLPFGYTGCGGNENNFADPRICRQRC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/34 (41%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 14/34 (41%)

Return to query results.
Submit another query.